PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe1G078800.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family TALE
Protein Properties Length: 723aa    MW: 79568.3 Da    PI: 7.1604
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe1G078800.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.13.5e-094174541954
                        HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
           Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                        Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  Aqcoe1G078800.3.p 417 FEHflHPYPKDTDKLMLAKQTGLTRSQVSNWFINARVR 454
                        664459******************************88 PP

2BELL1246e-40280351172
               BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                        e+qelq+kkakL+s+l+eV++rY+qy++q+q+v+ssFe++ag gsak Yt+lAl++iS++FrcLkdai++qi
  Aqcoe1G078800.3.p 280 EKQELQMKKAKLISMLDEVEQRYRQYHHQMQIVVSSFEQAAGFGSAKTYTALALQTISKQFRCLKDAISGQI 351
                        689********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005749.8E-65208349IPR006563POX domain
PfamPF075262.3E-50213348IPR006563POX domain
PROSITE profilePS5007112.034395458IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.7E-28397471IPR009057Homeodomain-like
SMARTSM003898.8E-9398462IPR001356Homeobox domain
CDDcd000861.30E-11398459No hitNo description
SuperFamilySSF466894.71E-17399465IPR009057Homeodomain-like
PfamPF059206.5E-18415454IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009610Biological Processresponse to symbiotic fungus
GO:0009737Biological Processresponse to abscisic acid
GO:0010197Biological Processpolar nucleus fusion
GO:0010201Biological Processresponse to continuous far red light stimulus by the high-irradiance response system
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 723 aa     Download sequence    Send to blast
MATYFHGNPE IQADGLQTLY LMNPGYVGYS DTQQQPNMVF LNSAVGNSMN LSQSPQQNQH  60
FVGIPLQATP ISPTAASASQ QDPNRHSVHP QHEMSAIHGF VPRVQYNLWT PVDQSNQHQQ  120
QNLATISSVR VNNSINVDDV SSRLGLRRSV VTPPQQGLSL SLSSQQPGYG PYQTDSEIPP  180
TTAPTSGEDI RVSGGSSSSA SGISNGTSSM QSVLLGSKYL KAAQQLLDEV VNVGKGIKTE  240
LSKGTKEQIK ISNELSGVAG DSSTGGETST KRGAELTTTE KQELQMKKAK LISMLDEVEQ  300
RYRQYHHQMQ IVVSSFEQAA GFGSAKTYTA LALQTISKQF RCLKDAISGQ IRLTSKSLGE  360
DDCLGSGKVE GSRLRFVDHQ LRQQRALQQL GMIQHNAWRP QRGLPERSVS ILRAWLFEHF  420
LHPYPKDTDK LMLAKQTGLT RSQVSNWFIN ARVRLWKPMV EEMYTEETKD QEHNGTEGKS  480
KNEFTEESGS KSNGHQENSP SRTDQTRNVS SNQNSPREPN APPTSVSNPT IPTSTMEENF  540
RGEAGFFLMG SSNIEGITQG SNKKSRNTEM QNSPTSFHSI DMDMKPNETD RDLCMKFGND  600
RQSRDGYSLI TATTNHGGGF GAYSMGEMGR FDSDQFTTRF SGNGVSLTLG LPHCENLPLS  660
GAQQNYLTNQ NIQLGRRLEL GGAEPNEFCG MNSQQPSTTA YENINMQNRK RFAAQLLPDF  720
VA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A6e-16404462563Homeobox protein Meis2
3k2a_B6e-16404462563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010247184.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_010247191.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_010247201.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_010247208.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_010247219.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_010247226.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_010247233.10.0PREDICTED: BEL1-like homeodomain protein 1
SwissprotQ9SJ561e-163BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLF6HAC50.0F6HAC5_VITVI; Putative uncharacterized protein
STRINGVIT_06s0009g00410.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-143BEL1-like homeodomain 1